PDBe-KB: UniProt Coverage View:
Q9DCT2
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 6g72, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6g72_entity_3_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6g72</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 6g72, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6g72_entity_3_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6g72</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 6g72, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6g72_entity_3_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6g72</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Top view.")
Chain: C
Length: 263 amino acids
Theoretical weight: 30.19 KDa
Source organism: Mus musculus
UniProt:
FASTA Sequence
Length: 263 amino acids
Theoretical weight: 30.19 KDa
Source organism: Mus musculus
UniProt:
- Canonical: Q9DCT2 (Residues: 1-263; Coverage: 100%)
FASTA Sequence
>pdb|6g72|C
MAAAAARVWCRGLLGAASVGRGAGRPSVLWQHVRRESAAADKRPTVRPRSDVTHKQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPETK
PDBe-KB: UniProt Coverage View:
Q9DCT2