› › General transcription and DNA repair factor IIH subunit TFB5

General transcription and DNA repair factor IIH subunit TFB5 in PDB entry 6gym, assembly 1, front view.
General transcription and DNA repair factor IIH subunit TFB5 in PDB entry 6gym, assembly 1, side view.
General transcription and DNA repair factor IIH subunit TFB5 in PDB entry 6gym, assembly 1, top view.
Chain: 5
Length: 72 amino acids
Theoretical weight: 8.24 KDa
Source organism: Saccharomyces cerevisiae S288C
Expression system: Trichoplusia ni
UniProt:
  • Canonical: Q3E7C1 (Residues: 1-72; Coverage: 100%)
Gene names: TFB5, YDR079C-A
FASTA Sequence
>pdb|6gym|5
MARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYNPMDEEENQ
PDBe-KB: UniProt Coverage View: Q3E7C1  

Quick links

Search similar proteins