Gelsolin in PDB entry 6i4k ‹ PDBe

Chain: G
Length: 127 amino acids
Theoretical weight: 14.21 KDa
Source organism: Mus musculus
Expression system: Escherichia coli
UniProt:

Canonical: P13020 (Residues: 50-174; Coverage: 17%)

Gene names: Gsb, Gsn
FASTA Sequence


    >pdb|6i4k|G

GPMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGF

PDBe-KB: UniProt Coverage View: P13020

Loading Protvista...

6i4k:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.