Large ribosomal subunit protein mL55

Chain: m
Length: 128 amino acids
Theoretical weight: 15.16 KDa
Source organism: Homo sapiens
UniProt:
  • Canonical: Q7Z7F7 (Residues: 1-128; Coverage: 100%)
Gene names: MRPL55, UNQ5835/PRO19675
FASTA Sequence
>pdb|6i9r|m
MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
PDBe-KB: UniProt Coverage View: Q7Z7F7  
Loading Protvista...
Loading...
 
 
  6i9r: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.