NAD(P)H-quinone oxidoreductase subunit K in PDB entry 6l7o ‹ PDBe

Chain: K
Length: 237 amino acids
Theoretical weight: 25.77 KDa
Source organism: Thermosynechococcus vestitus BP-1
UniProt:

Canonical: Q8DKZ4 (Residues: 1-237; Coverage: 100%)

Gene names: ndhK, tlr0705
FASTA Sequence


    >pdb|6l7o|K

MTNTTSPAILNPIARPEVPQELAENIILTSLNDVYDWARLSSLWPLMYGTACCFIEFAAMIGSRFDFDRFGLVPRNSPRQADLIITSGTITMKMAPALVRLYEQMPSPKYVIAMGACTITGGMFSSDSYSAVRGVDKLIPVDVYLPGCPPRPEAIMDAIVKLRKKIANEHINERGNLAQTHRLFTAKHKMKPVPPILTGQYLNAPSRQAPPPALAAAMGIAVPALGEAVSETTSVAE

6l7o:K

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.