PDBe-KB: UniProt Coverage View:
Q5ZIS0
![Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial in PDB entry 6myu, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6myu_entity_4_front_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>6myu</span> contains 1 copy of <span class='highlight'>Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial</span>. Front view.")
![Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial in PDB entry 6myu, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6myu_entity_4_side_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>6myu</span> contains 1 copy of <span class='highlight'>Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial</span>. Side view.")
![Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial in PDB entry 6myu, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6myu_entity_4_top_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>6myu</span> contains 1 copy of <span class='highlight'>Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial</span>. Top view.")
Chain: D
Length: 103 amino acids
Theoretical weight: 10.97 KDa
Source organism: Gallus gallus
UniProt:
FASTA Sequence
Length: 103 amino acids
Theoretical weight: 10.97 KDa
Source organism: Gallus gallus
UniProt:
- Canonical: Q5ZIS0 (Residues: 55-157; Coverage: 66%)
FASTA Sequence
>pdb|6myu|D
GSSKAASLHWTSERAVSALLLGLLPAAYLYPGPAVDYSLAAALTLHGHWGLGQVITDYVHGDTPIKVANTGLYVLSAITFTGLCYFNYYDVGICKAVAMLWSI
PDBe-KB: UniProt Coverage View:
Q5ZIS0