› › Capsid assembly scaffolding protein; Microtubule-associated protein RP/EB family member 1; Myosin-7

Capsid assembly scaffolding protein in PDB entry 6pfp, assembly 1, front view.
Capsid assembly scaffolding protein in PDB entry 6pfp, assembly 1, side view.
Capsid assembly scaffolding protein in PDB entry 6pfp, assembly 1, top view.
Chains: A, B, C, D
Length: 166 amino acids
Theoretical weight: 19.2 KDa
Source organisms: Expression system: Escherichia coli
UniProt:
  • Canonical: P13848 (Residues: 2-48; Coverage: 48%)
  • Canonical: P12883 (Residues: 1473-1536; Coverage: 3%)
  • Canonical: Q15691 (Residues: 207-257; Coverage: 19%)
    • nullnullnull
Gene names: 7, MAPRE1, MYH7, MYHCB
FASTA Sequence
>pdb|6pfp|A B C D
GGSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD
PDBe-KB: UniProt Coverage View: P13848   P12883   Q15691  
Loading Protvista...
Loading...
 
 
  6pfp: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins