![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 6qc6, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6qc6_entity_9_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6qc6</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 6qc6, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6qc6_entity_9_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6qc6</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 6qc6, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6qc6_entity_9_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6qc6</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Top view.")
Chain: S6
Length: 96 amino acids
Theoretical weight: 10.65 KDa
Source organism: Ovis aries
Length: 96 amino acids
Theoretical weight: 10.65 KDa
Source organism: Ovis aries
>pdb|6qc6|S6
GVRTSPTGEKVTHTGQVYDDEDYRRVRFVGRQKEVNENFAIDLIAEQPVSQVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQQHH