› › Small nuclear ribonucleoprotein-associated proteins B and B'

Small nuclear ribonucleoprotein-associated proteins B and B' in PDB entry 6qdv, assembly 1, front view.
Small nuclear ribonucleoprotein-associated proteins B and B' in PDB entry 6qdv, assembly 1, side view.
Small nuclear ribonucleoprotein-associated proteins B and B' in PDB entry 6qdv, assembly 1, top view.
Chains: b, k
Length: 82 amino acids
Theoretical weight: 9.55 KDa
Source organism: Homo sapiens
UniProt:
  • Canonical: P14678 (Residues: 6-87; Coverage: 34%)
Gene names: COD, SNRPB, SNRPB1
FASTA Sequence
>pdb|6qdv|b k
SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPP
PDBe-KB: UniProt Coverage View: P14678  

Quick links

Search similar proteins