Eukaryotic peptide chain release factor GTP-binding subunit ERF3A in PDB entry 6xk9 ‹ PDBe

Chains: A, X
Length: 199 amino acids
Theoretical weight: 22 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: P15170 (Residues: 300-496; Coverage: 40%)

Gene names: ERF3A, GSPT1
FASTA Sequence


    >pdb|6xk9|A X

GSGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP

PDBe-KB: UniProt Coverage View: P15170

Loading Protvista...

6xk9:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.