NADH-ubiquinone oxidoreductase 21.3 kDa subunit in PDB entry 6y79 ‹ PDBe

Chain: Z
Length: 182 amino acids
Theoretical weight: 19.77 KDa
Source organism: Yarrowia lipolytica
UniProt:

Canonical: Q6CI10 (Residues: 1-182; Coverage: 100%)

Gene name: YALI0_A02651g
FASTA Sequence


    >pdb|6y79|Z

MLPGGPVPVFKKYTVGSKGIWEKLRVLLAIAPNRSTGNPIVPLYRVPTPGSRPEANVYQDPSSYPTNDIAENPYWKRDHRRAYPQTAFFDQKTVTGLLELGSEATPRIADGEAGTKALANIANGGVSFTQALGKSSKDVIYGEVLTVNGLPPVAPTLAPKQWKIIEGEAAIYPKGYPCRTFH

6y79:Z

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.