YALI0D04939p in PDB entry 6y79 ‹ PDBe

Chain: a
Length: 149 amino acids
Theoretical weight: 17.33 KDa
Source organism: Yarrowia lipolytica
UniProt:

Canonical: Q6CA88 (Residues: 1-149; Coverage: 100%)

Gene name: YALI0_D04939g
FASTA Sequence


    >pdb|6y79|a

MLSRRAVTMLRSPVARVAQVQVRGIRASFDKAEEPMLGDYPDIDPFPAQLKNPYKKYDDQQDRRNLEEPLSVNDDLYDMWSPDRFTHFKNQDALKYFIGFLTIFFGASYVATYFVPEKAAIPREFPYEGLWKESGGTEKSKAFFGQRSE

6y79:a

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.