tRNA-splicing endonuclease subunit Sen34 in PDB entry 6z9u ‹ PDBe

Chains: A, C
Length: 104 amino acids
Theoretical weight: 11.76 KDa
Source organism: Homo sapiens
Expression system: Spodoptera frugiperda
UniProt:

Canonical: Q9BSV6 (Residues: 208-310; Coverage: 33%)

Gene names: LENG5, SEN34, TSEN34
FASTA Sequence


    >pdb|6z9u|A C

MDWPHAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWAPEDTIPLQDLVAAGRLGTSVRKTLLLCSPQPDGKVVYTSLQWASLQ

PDBe-KB: UniProt Coverage View: Q9BSV6

Loading Protvista...

6z9u:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.