› › NADH:ubiquinone oxidoreductase subunit S5

NADH:ubiquinone oxidoreductase subunit S5 in PDB entry 6zkb, assembly 1, front view.
NADH:ubiquinone oxidoreductase subunit S5 in PDB entry 6zkb, assembly 1, side view.
NADH:ubiquinone oxidoreductase subunit S5 in PDB entry 6zkb, assembly 1, top view.
Chain: l
Length: 106 amino acids
Theoretical weight: 12.61 KDa
Source organism: Ovis aries
FASTA Sequence
>pdb|6zkb|l
MPFFDVQKKLGVDLDHWMTIQSAEQPHRIPARCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLNAIKRQRDKLIKEGKYTPPPHHSGQEDLRP
1106102030405060708090100
 
50100MPFFDVQKKLGVDLDHWMTIQSAEQPHRIPARCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLNAIKRQRDKLIKEGKYTPPPHHSGQEDLRP
Chains
Chain K (auth l)
Domains
Secondary structure
Flexibility predictions
Ligand binding sites
Interaction interfaces
Sequence conservation
Loading...
 
 
  6zkb:l 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins