› › Mitochondrial complex I, B14.7 subunit

Mitochondrial complex I, B14.7 subunit in PDB entry 6zkf, assembly 1, front view.
Mitochondrial complex I, B14.7 subunit in PDB entry 6zkf, assembly 1, side view.
Mitochondrial complex I, B14.7 subunit in PDB entry 6zkf, assembly 1, top view.
Chain: V
Length: 141 amino acids
Theoretical weight: 14.78 KDa
Source organism: Ovis aries
FASTA Sequence
>pdb|6zkf|V
MAKTLLHQYWDIPEGTECHRKTYAATSIGGASGLVVSAYSVALKTPTSFLEGVARTGRYTFTAAAIGAIFGLTSCISAQVREKPDDPLNYLIGGCAGGLTLGARTRSYGIGAAACAYMGLTAALVKMGQLEGWKVFAEPKV
1141102030405060708090100110120130140
 
50100
Chains
Chain O (auth V)
Domains
Secondary structure
Flexibility predictions
Ligand binding sites
Sequence conservation
Loading...
 
 
  6zkf:V 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins