› › NADH:ubiquinone oxidoreductase subunit A3

NADH:ubiquinone oxidoreductase subunit A3 in PDB entry 6zkf, assembly 1, front view.
NADH:ubiquinone oxidoreductase subunit A3 in PDB entry 6zkf, assembly 1, side view.
NADH:ubiquinone oxidoreductase subunit A3 in PDB entry 6zkf, assembly 1, top view.
Chain: m
Length: 84 amino acids
Theoretical weight: 9.33 KDa
Source organism: Ovis aries
FASTA Sequence
>pdb|6zkf|m
MAPRVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRATPYNYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKRL
1841020304050607080
 
20406080MAPRVAAFLKNVWAKEPVLVASFAIAGLAVILPTLSPYTKYSLMINRATPYNYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKRL
Chains
Chain FA (auth m)
Domains
Secondary structure
Flexibility predictions
Ligand binding sites
Sequence conservation
Loading...
 
 
  6zkf:m 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins