![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 in PDB entry 6zkk, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6zkk_entity_24_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6zkk</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 in PDB entry 6zkk, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6zkk_entity_24_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6zkk</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 in PDB entry 6zkk, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6zkk_entity_24_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>6zkk</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2</span>. Top view.")
Chain: e
Length: 99 amino acids
Theoretical weight: 11.1 KDa
Source organism: Ovis aries
Length: 99 amino acids
Theoretical weight: 11.1 KDa
Source organism: Ovis aries
>pdb|6zkk|e
MAAAAAIRGVRGKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSSKA