Small ribosomal subunit protein uS3m

Chain: AC
Length: 167 amino acids
Theoretical weight: 19.05 KDa
Source organism: Homo sapiens
UniProt:
  • Canonical: Q96EL2 (Residues: 1-167; Coverage: 100%)
Gene names: HSPC335, MRPS24
FASTA Sequence
>pdb|6zsc|AC
MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL
PDBe-KB: UniProt Coverage View: Q96EL2  
Loading Protvista...
Loading...
 
 
  6zsc: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...