› › Small ribosomal subunit protein uS17m

Small ribosomal subunit protein uS17m in PDB entry 6zsc, assembly 1, front view.
Small ribosomal subunit protein uS17m in PDB entry 6zsc, assembly 1, side view.
Small ribosomal subunit protein uS17m in PDB entry 6zsc, assembly 1, top view.
Chain: AN
Length: 130 amino acids
Theoretical weight: 14.53 KDa
Source organism: Homo sapiens
UniProt:
  • Canonical: Q9Y2R5 (Residues: 1-130; Coverage: 100%)
Gene names: HSPC011, MRPS17, RPMS17
FASTA Sequence
>pdb|6zsc|AN
MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ
PDBe-KB: UniProt Coverage View: Q9Y2R5  
Loading Protvista...
Loading...
 
 
  6zsc: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins