Large ribosomal subunit protein uL30m in PDB entry 6zsc ‹ PDBe

Chain: XZ
Length: 161 amino acids
Theoretical weight: 18.58 KDa
Source organism: Homo sapiens
UniProt:

Canonical: Q8TCC3 (Residues: 1-161; Coverage: 100%)

Gene names: HSPC249, MRPL28, MRPL30, RPML28
FASTA Sequence


    >pdb|6zsc|XZ

MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES

PDBe-KB: UniProt Coverage View: Q8TCC3

Loading Protvista...

6zsc:XZ

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.