NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

Chain: l
Length: 186 amino acids
Theoretical weight: 21.9 KDa
Source organism: Mus musculus
UniProt:
  • Canonical: Q9D6J5 (Residues: 1-186; Coverage: 100%)
Gene name: Ndufb8
FASTA Sequence
>pdb|6ztq|l
MAAARAAALGVRWLQRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI
PDBe-KB: UniProt Coverage View: Q9D6J5  
Loading Protvista...
 
NC
 
  6ztq:l 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...