NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

Chain: h
Length: 125 amino acids
Theoretical weight: 14.47 KDa
Source organism: Bos taurus
UniProt:
  • Canonical: Q8HXG5 (Residues: 30-154; Coverage: 81%)
Gene name: NDUFB11
FASTA Sequence
>pdb|7dgs|h
ESSSSRAVIAPSTLAGKRPSEPTLRWQEDPEPEDENLYEKNPDSHGYDKDPAVDIWNMRVVFFFGFSIVLVLGSTFVAYLPDYRMQEWARREAERLVKYREAHGLPIMESNCFDPSKIQLPEDED
PDBe-KB: UniProt Coverage View: Q8HXG5  
Loading...
 
 
  7dgs: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.