Cytochrome b-c1 complex subunit 10

Chains: A3, t
Length: 56 amino acids
Theoretical weight: 6.53 KDa
Source organism: Bos taurus
UniProt:
  • Canonical: P07552 (Residues: 1-56; Coverage: 100%)
Gene names: UQCR, UQCR11
FASTA Sequence
>pdb|7dgs|A3 t
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKKDD
PDBe-KB: UniProt Coverage View: P07552  
Loading...
 
 
  7dgs: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.