› › Cytochrome c oxidase subunit 7C, mitochondrial

Cytochrome c oxidase subunit 7C, mitochondrial in PDB entry 7dgs, assembly 1, front view.
Cytochrome c oxidase subunit 7C, mitochondrial in PDB entry 7dgs, assembly 1, side view.
Cytochrome c oxidase subunit 7C, mitochondrial in PDB entry 7dgs, assembly 1, top view.
Chain: B1
Length: 63 amino acids
Theoretical weight: 7.34 KDa
Source organism: Bos taurus
UniProt:
  • Canonical: P00430 (Residues: 1-63; Coverage: 100%)
Gene names: COX7C, COX7CP1
FASTA Sequence
>pdb|7dgs|B1
MLGQSIRRFTTSVVRRSHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK
PDBe-KB: UniProt Coverage View: P00430  
Loading...
 
 
  7dgs: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins