› › Bifunctional peptidase and arginyl-hydroxylase JMJD5

Bifunctional peptidase and arginyl-hydroxylase JMJD5 in PDB entry 7dyt, assembly 1, front view.
Bifunctional peptidase and arginyl-hydroxylase JMJD5 in PDB entry 7dyt, assembly 1, side view.
Bifunctional peptidase and arginyl-hydroxylase JMJD5 in PDB entry 7dyt, assembly 1, top view.
Chain: A
Length: 235 amino acids
Theoretical weight: 27.26 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: Q8N371 (Residues: 183-416; Coverage: 56%)
Gene names: JMJD5, KDM8
FASTA Sequence
>pdb|7dyt|A
STVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
PDBe-KB: UniProt Coverage View: Q8N371  

Quick links

Search similar proteins