› › Nanobody DL4

Nanobody DL4 in PDB entry 7f5g, assembly 2, front view.
Nanobody DL4 in PDB entry 7f5g, assembly 2, side view.
Nanobody DL4 in PDB entry 7f5g, assembly 2, top view.
Chains: B, D
Length: 146 amino acids
Theoretical weight: 16.19 KDa
Source organism: Vicugna pacos
Expression system: Escherichia coli
FASTA Sequence
>pdb|7f5g|B D
GSSSQVQLQESGGGLVQPGGSLRLSCAASGSFFEFGTVGWFRQAPGKQRELVSRITGNDHRYYADSVKGRFTISRDNDETTVYLQMDSLKPEDTAIYHCNILEGQRWSNYWGQGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH
114620406080100120140
 
50100
Chains
RSRZ Outlier Chain B (auth B)
Chain B (auth B)
RSRZ Outlier Chain D (auth D)
Chain D (auth D)
Domains
Secondary structure
Ligand binding sites
Interaction interfaces
Loading...
 
 
  7f5g:B 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins