Fab 11F4 heavy chain in PDB entry 7jr7 ‹ PDBe

Chain: C
Length: 220 amino acids
Theoretical weight: 24.17 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens

FASTA Sequence


    >pdb|7jr7|C

DVQLQESGPGLVKPSQSLSLTCTITGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTYYNPSLKSRFSITRDTSRNQFFLQFNSVTTEDTGTYFCARMITTVYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD

7jr7:C

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.