CRISPR-associated endoribonuclease Cas2 in PDB entry 7mi5 ‹ PDBe

Chains: E, F
Length: 95 amino acids
Theoretical weight: 11.19 KDa
Source organism: Geobacter sulfurreducens PCA
Expression system: Escherichia coli BL21(DE3)
UniProt:

Canonical: Q74H35 (Residues: 1-95; Coverage: 100%)

Gene names: GSU0058, cas2
FASTA Sequence


    >pdb|7mi5|E F

MEHLYIVSYDIRNQRRWRRLFKTMHGFGCWLQLSVFQCRLDRIRIIKMEAAINEIVNHAEDHVLILDLGPAENVKPKVSSIGKTFDPILRQAVIV

7mi5:E

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.