ATP synthase subunit a in PDB entry 7njn ‹ PDBe

Chain: a
Length: 252 amino acids
Theoretical weight: 27.57 KDa
Source organism: Mycolicibacterium smegmatis MC2 155
Expression system: Mycolicibacterium smegmatis
UniProt:

Canonical: A0R206 (Residues: 1-252; Coverage: 100%)

Gene names: MSMEG_4942, atpB
FASTA Sequence


    >pdb|7njn|a

MLAAEEGGAAIHVGHHTLVFELFGMTFNGDTILATAVTAVIVIALAFYLRAKVTSTGVPSGVQLFWEALTIQMRQQIEGSIGMKIAPFVLPLSVTIFVFILISNWLAVLPLQYGGADGAAAELYKAPASDINFVLALALFVFVCYHAAGIWRRGIVGHPIKVVKGHVAFLAPINIVEELAKPISLALRLFGNIFAGGILVALIAMFPWYIQWFPNAVWKTFDLFVGLIQAFIFSLLTILYFSQSMELDHEDH

PDBe-KB: UniProt Coverage View: A0R206

Loading Protvista...

7njn:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.