› › 30S ribosomal protein S21

30S ribosomal protein S21 in PDB entry 7nso, assembly 1, front view.
30S ribosomal protein S21 in PDB entry 7nso, assembly 1, side view.
30S ribosomal protein S21 in PDB entry 7nso, assembly 1, top view.
Chain: u
Length: 70 amino acids
Theoretical weight: 8.39 KDa
Source organism: Escherichia coli
FASTA Sequence
>pdb|7nso|u
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
170510152025303540455055606570
 
204060PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
Chains
Chain CB (auth u)
Domains
Interaction interfaces
Sequence conservation
 
NC
 
  7nso:u 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins