Large ribosomal subunit protein mL54 in PDB entry 7oid ‹ PDBe

Chain: l
Length: 138 amino acids
Theoretical weight: 15.84 KDa
Source organism: Homo sapiens
UniProt:

Canonical: Q6P161 (Residues: 1-138; Coverage: 100%)

Gene name: MRPL54
FASTA Sequence


    >pdb|7oid|l

MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL

PDBe-KB: UniProt Coverage View: Q6P161

Loading Protvista...

7oid:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.