Large ribosomal subunit protein mL63

Chain: o
Length: 102 amino acids
Theoretical weight: 12.29 KDa
Source organism: Homo sapiens
UniProt:
  • Canonical: Q9BQC6 (Residues: 1-102; Coverage: 100%)
Gene names: MRP63, MRPL57
FASTA Sequence
>pdb|7oid|o
MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
PDBe-KB: UniProt Coverage View: Q9BQC6  
Loading Protvista...
Loading...
 
 
  7oid: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...