› › 60S ribosomal protein L28-like protein

60S ribosomal protein L28-like protein in PDB entry 7old, assembly 1, front view.
60S ribosomal protein L28-like protein in PDB entry 7old, assembly 1, side view.
60S ribosomal protein L28-like protein in PDB entry 7old, assembly 1, top view.
Chain: La
Length: 149 amino acids
Theoretical weight: 16.85 KDa
Source organism: Chaetomium thermophilum var. thermophilum DSM 1495
FASTA Sequence
>pdb|7old|La
MPTRFSKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLLRNHYWRPSINIDKLWSLVPSDVREQYLSGQKKDTAPVIDLLSHGYAKLLGKGRLPEIPVVVRARYVSAEAERKVKEAGGVVELVA
114920406080100120140
 
50100150
Chains
Chain IA (auth La)
Domains
Sequence conservation
Loading...
 
 
  7old: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins