› › 40S ribosomal protein S8

40S ribosomal protein S8 in PDB entry 7osa, assembly 1, front view.
40S ribosomal protein S8 in PDB entry 7osa, assembly 1, side view.
40S ribosomal protein S8 in PDB entry 7osa, assembly 1, top view.
Chain: eS8
Length: 200 amino acids
Theoretical weight: 22.54 KDa
Source organism: Saccharomyces cerevisiae
FASTA Sequence
>pdb|7osa|eS8
MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGGNKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWFEAHYGQTLGKKKNVKEEETVAKSKNAERKWAARAASAKIESSVESQFSAGRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK
120020406080100120140160180200
 
50100150200
Chains
RSRZ Outlier Chain CB (auth eS8)
Chain CB (auth eS8)
Domains
Sequence conservation
 
NC
 
  7osa:eS8 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins