› › 40S ribosomal protein S15

RPS15 isoform 1 in PDB entry 7osa, assembly 1, front view.
RPS15 isoform 1 in PDB entry 7osa, assembly 1, side view.
RPS15 isoform 1 in PDB entry 7osa, assembly 1, top view.
Chain: uS19
Length: 142 amino acids
Theoretical weight: 16.03 KDa
Source organism: Saccharomyces cerevisiae
FASTA Sequence
>pdb|7osa|uS19
MSQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK
1142102030405060708090100110120130140
 
50100
Chains
RSRZ Outlier Chain JB (auth uS19)
Chain JB (auth uS19)
Domains
Sequence conservation
Loading...
 
 
  7osa: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins