› › 40S ribosomal protein S25

40S ribosomal protein S25 in PDB entry 7osa, assembly 1, front view.
40S ribosomal protein S25 in PDB entry 7osa, assembly 1, side view.
40S ribosomal protein S25 in PDB entry 7osa, assembly 1, top view.
Chain: eS25
Length: 108 amino acids
Theoretical weight: 12.07 KDa
Source organism: Saccharomyces cerevisiae
FASTA Sequence
>pdb|7osa|eS25
MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRATASE
1108102030405060708090100
 
50100
Chains
RSRZ Outlier Chain TB (auth eS25)
Chain TB (auth eS25)
Domains
Sequence conservation
Loading...
 
 
  7osa: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins