› › 40S ribosomal protein S30

40S ribosomal protein S30 in PDB entry 7osa, assembly 1, front view.
40S ribosomal protein S30 in PDB entry 7osa, assembly 1, side view.
40S ribosomal protein S30 in PDB entry 7osa, assembly 1, top view.
Chain: eS30
Length: 63 amino acids
Theoretical weight: 7.14 KDa
Source organism: Saccharomyces cerevisiae
FASTA Sequence
>pdb|7osa|eS30
MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGPSVQ
16351015202530354045505560
 
204060MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGPSVQ
Chains
RSRZ Outlier Chain YB (auth eS30)
Chain YB (auth eS30)
Domains
Sequence conservation
Loading...
 
 
  7osa: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins