ATP synthase subunit c in PDB entry 7p2y ‹ PDBe

Chains: G, H, J, K, L, O, P, Q, R, S
Length: 81 amino acids
Theoretical weight: 8.36 KDa
Source organism: Acinetobacter baumannii ATCC 17978
UniProt:

Canonical: A3M139 (Residues: 1-81; Coverage: 100%)

Gene names: A1S_0150, atpE
FASTA Sequence


    >pdb|7p2y|G H J K L O P Q R S

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG

7p2y:J

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.