Large ribosomal subunit protein bL17

Chain: m
Length: 124 amino acids
Theoretical weight: 14.27 KDa
Source organism: Mycoplasmoides pneumoniae M129
UniProt:
  • Canonical: Q59547 (Residues: 1-124; Coverage: 100%)
Gene names: MP639, MPN_192, rplQ
FASTA Sequence
>pdb|7pau|m
MSYINKPGKTSAWRVMTVRQQVSAVLAYGKIETTLKKAKNTQKRLDKLITLAKVDNFNNRRQVKKWLLNTNLFDVDQLMDHLFSKVAPKYEKTPGGYSRVLKLGPRRGDATEMAILQLTDAKYK
PDBe-KB: UniProt Coverage View: Q59547  
Loading Protvista...
Loading...
 
 
  7pau:m 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.