Large ribosomal subunit protein bL31

Chain: x
Length: 97 amino acids
Theoretical weight: 10.98 KDa
Source organism: Mycoplasmoides pneumoniae M129
UniProt:
  • Canonical: P78020 (Residues: 1-97; Coverage: 100%)
Gene names: MP476, MPN_360, rpmE
FASTA Sequence
>pdb|7pau|x
MKKDFHFPSQSVSFKCASCSNSFTIESTLKQKEITIDICGKCHPFYIGELTKQTVHGRAEKLSGKFNAGKAFLENKTPKKAKGKTEEYTKHRSLNEL
PDBe-KB: UniProt Coverage View: P78020  
Loading Protvista...
Loading...
 
 
  7pau: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...