Small ribosomal subunit protein bS16 in PDB entry 7qv3 ‹ PDBe

Chain: p
Length: 90 amino acids
Theoretical weight: 10.15 KDa
Source organism: Bacillus subtilis subsp. subtilis str. 168
UniProt:

Canonical: P21474 (Residues: 1-90; Coverage: 100%)

Gene names: BSU15990, rpsP
FASTA Sequence


    >pdb|7qv3|p

MAVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAKQGK

PDBe-KB: UniProt Coverage View: P21474

Loading Protvista...

7qv3:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.