› › Large ribosomal subunit protein bL20

Large ribosomal subunit protein bL20 in PDB entry 7rq8, assembly 2, front view.
Large ribosomal subunit protein bL20 in PDB entry 7rq8, assembly 2, side view.
Large ribosomal subunit protein bL20 in PDB entry 7rq8, assembly 2, top view.
Chains: 1U, 2U
Length: 118 amino acids
Theoretical weight: 13.78 KDa
Source organism: Thermus thermophilus HB8
UniProt:
  • Canonical: P60491 (Residues: 1-118; Coverage: 100%)
Gene names: TTHA0553, rplT
FASTA Sequence
>pdb|7rq8|1U 2U
MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQG
PDBe-KB: UniProt Coverage View: P60491  
Loading Protvista...
Loading...
 
 
  7rq8: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins