Cytochrome c1 in PDB entry 7tlj ‹ PDBe

Chains: B, F
Length: 272 amino acids
Theoretical weight: 29.59 KDa
Source organism: Cereibacter sphaeroides
Expression system: Escherichia coli
UniProt:

Canonical: Q02760 (Residues: 23-285; Coverage: 100%)

Gene names: fbcC, petC
FASTA Sequence


    >pdb|7tlj|B F

AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVKGKKKTNVGTGHHHHHH

7tlj:B

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.