› › BG24 inferred germline Fab with mature CDR3s heavy chain

BG24 inferred germline Fab with mature CDR3s heavy chain in PDB entry 7ugo, assembly 1, front view.
BG24 inferred germline Fab with mature CDR3s heavy chain in PDB entry 7ugo, assembly 1, side view.
BG24 inferred germline Fab with mature CDR3s heavy chain in PDB entry 7ugo, assembly 1, top view.
Chains: G, H, I
Length: 125 amino acids
Theoretical weight: 13.7 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
FASTA Sequence
>pdb|7ugo|G H I
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCATQVKLDSSAGYPFDIWGQGTMVTVSSAS
1125102030405060708090100110120
 
50100
Chains
Chain M (auth G)
Chain N (auth H)
Chain O (auth I)
Domains
Secondary structure
Sequence conservation
 
NC
 
  7ugo:G 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins