› › Structure analysis

Cryo-EM structure of human NTCP complexed with YN69202Fab

Electron Microscopy
3.41Å resolution
PDB entry 7vad coloured by chain, front view.
PDB entry 7vad coloured by chain, side view.
PDB entry 7vad coloured by chain, top view.
Source organisms:
Assembly composition:
hetero trimer (preferred)
Entry contents: 3 distinct polypeptide molecules

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Hepatic sodium/bile acid cotransporter and IG-heavy chain and IG-light kappa chain
hide full assembly name
Multimeric state: hetero trimer
Accessible surface area: 36644.73 Å2
Buried surface area: 5646.43 Å2
Dissociation area: 1,138.34 Å2
Dissociation energy (ΔGdiss): -3.26 kcal/mol
Dissociation entropy (TΔSdiss): 13.49 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-278772

Macromolecules

Hepatic sodium/bile acid cotransporter
Chain: A
Length: 343 amino acids
Theoretical weight: 38.14 KDa
Source organism: Homo sapiens
Expression system: Spodoptera frugiperda
Sodium/bile acid cotransporter in PDB entry 7vad, assembly 1, front view.
Sodium/bile acid cotransporter in PDB entry 7vad, assembly 1, side view.
Sodium/bile acid cotransporter in PDB entry 7vad, assembly 1, top view.
134350100150200250300
 
100200300MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCANVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIENLYFQGDYKDDDDKHHHHHHHH
UniProt
Q14973
Chains
Domains
Secondary structure
Sequence conservation
Molecule details ›

Search similar proteins

Fab heavy chain from antibody IgG clone number YN69202
Chain: H
Length: 249 amino acids
Theoretical weight: 26.57 KDa
Source organism: Ondatra zibethicus
Expression system: Spodoptera frugiperda
Fab heavy chain from antibody IgG clone number YN69202 in PDB entry 7vad, assembly 1, front view.
Fab heavy chain from antibody IgG clone number YN69202 in PDB entry 7vad, assembly 1, side view.
Fab heavy chain from antibody IgG clone number YN69202 in PDB entry 7vad, assembly 1, top view.
124920406080100120140160180200220240
 
100200EVQLQQSGPELVKPGASVKMSCKASGYTFTSYIIHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKGTLTSDKSSSTAYMELSSLTSEDSAVYYCARSYYDGIPHYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPS
Chains
Chain B (auth H)
Domains
Secondary structure
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Fab light chain from antibody IgG clone number YN69202
Chain: L
Length: 219 amino acids
Theoretical weight: 24.32 KDa
Source organism: Ondatra zibethicus
Expression system: Spodoptera frugiperda
Fab light chain from antibody IgG clone number YN69202 in PDB entry 7vad, assembly 1, front view.
Fab light chain from antibody IgG clone number YN69202 in PDB entry 7vad, assembly 1, side view.
Fab light chain from antibody IgG clone number YN69202 in PDB entry 7vad, assembly 1, top view.
121920406080100120140160180200
 
100200DIVMTQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRRNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYLLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Chains
Chain C (auth L)
Domains
Secondary structure
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Quick links