PDBe-KB: UniProt Coverage View:
A1XQS6
![NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial in PDB entry 7vye, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7vye_entity_14_front_image-200x200.png "Hetero 29-meric assembly 1 of PDB entry <span class='highlight'>7vye</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial in PDB entry 7vye, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7vye_entity_14_side_image-200x200.png "Hetero 29-meric assembly 1 of PDB entry <span class='highlight'>7vye</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial in PDB entry 7vye, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7vye_entity_14_top_image-200x200.png "Hetero 29-meric assembly 1 of PDB entry <span class='highlight'>7vye</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial</span>. Top view.")
Chain: f
Length: 42 amino acids
Theoretical weight: 4.95 KDa
Source organism: Sus scrofa
UniProt:
FASTA Sequence
Length: 42 amino acids
Theoretical weight: 4.95 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: A1XQS6 (Residues: 35-76; Coverage: 55%)
FASTA Sequence
>pdb|7vye|f
PHGSPDWLKVGLTLGTSVFLWIYLIKQHKEDVLEYKRRNGLE
PDBe-KB: UniProt Coverage View:
A1XQS6