NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 7vz1 ‹ PDBe

Chain: C
Length: 156 amino acids
Theoretical weight: 17.87 KDa
Source organism: Sus scrofa
UniProt:

Canonical: A0A8D1TL60 (Residues: 41-196; Coverage: 80%)

Gene name: NDUFS7
FASTA Sequence


    >pdb|7vz1|C

SRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREKRLRIWYRR

7vz1:C

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.