PDBe-KB: UniProt Coverage View:
G8IFA6
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 7w1p, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7w1p_entity_11_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w1p</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 7w1p, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7w1p_entity_11_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w1p</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 7w1p, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7w1p_entity_11_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w1p</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Top view.")
Chain: L
Length: 125 amino acids
Theoretical weight: 14.44 KDa
Source organism: Sus scrofa
UniProt:
Length: 125 amino acids
Theoretical weight: 14.44 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: G8IFA6 (Residues: 51-175; Coverage: 71%)
>pdb|7w1p|L
QLIAVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWSSTADPLSNLVLTFSTKEDAVAFAEKNGWSFDVEERKVPKPKSKSYGANFSWNKRTRVSTK
PDBe-KB: UniProt Coverage View:
G8IFA6