PDBe-KB: UniProt Coverage View:
A0A286ZNN4
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 7w1p, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7w1p_entity_15_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w1p</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 7w1p, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7w1p_entity_15_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w1p</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial in PDB entry 7w1p, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7w1p_entity_15_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>7w1p</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial</span>. Top view.")
Chain: P
Length: 208 amino acids
Theoretical weight: 24.52 KDa
Source organism: Sus scrofa
UniProt:
FASTA Sequence
Length: 208 amino acids
Theoretical weight: 24.52 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: A0A286ZNN4 (Residues: 43-250; Coverage: 79%)
FASTA Sequence
>pdb|7w1p|P
TRPTIRPRNDVVHKQLSAFGQYVAEILPKYVQQVQVSCFNELEIFIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESSVTVYKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPE
PDBe-KB: UniProt Coverage View:
A0A286ZNN4