Histone H3 in PDB entry 7wlr ‹ PDBe

Chains: A, E
Length: 99 amino acids
Theoretical weight: 11.6 KDa
Source organism: Komagataella pastoris
Expression system: Escherichia coli
UniProt:

Canonical: A0A1B2JB78 (Residues: 39-137; Coverage: 72%)

Gene names: ATY40_BA7502079, ATY40_BA7504318
FASTA Sequence


    >pdb|7wlr|A E

KPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTIQKKDILLARRLRGERS

7wlr:A

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.